SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004057 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004057
Domain Number 1 Region: 113-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-42
Family Pentraxin (pentaxin) 0.00063
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004057
Domain Number - Region: 32-114
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.017
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004057   Gene: ENSFCAG00000004394   Transcript: ENSFCAT00000004394
Sequence length 302
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:5676203:5686465:1 gene:ENSFCAG00000004394 transcript:ENSFCAT00000004394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQTLKDRLESLEHQLRVNVSTAVLPGDFREVLQRRLGELESQLLRKVAELEDEKSLLHN
ETSAHRQKTESALNALLLRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYA
FTICLWLRSSALPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQLPLFVSDGKW
HHICITWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVLILGQEQDTVGGRFDATQAF
VGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLL
DL
Download sequence
Identical sequences ENSFCAP00000004057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]