SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004093 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004093
Domain Number 1 Region: 1082-1218,1306-1592
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.48e-109
Family Myotubularin-like phosphatases 0.00000529
Further Details:      
 
Domain Number 2 Region: 1661-1857
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-28
Family Pleckstrin-homology domain (PH domain) 0.00000224
Further Details:      
 
Domain Number 3 Region: 851-992
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000922
Family GRAM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004093   Gene: ENSFCAG00000004434   Transcript: ENSFCAT00000004435
Sequence length 1860
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:143923211:143944516:-1 gene:ENSFCAG00000004434 transcript:ENSFCAT00000004435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPERNPPTFFVAVLTDINSERH
YCACLTFWEPAEPTQEVVCTEDTTEREEEADEGGPVQLSPVTPGPPGQLFAPKTLVLVSR
LDHAEVFRNSLGLIYTIHVEGLNVGLENVIGNLLTCIIPLAGGSQRTISLGAGDRQVIQT
PLADSLPISRCSVALLFRQLGITNVLSLFCAALTEHKVLFLSRSYQRLSDACRGLLALLF
PLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQELLDVIVADLDGGTVTVPECV
HIPPLPEPLQSQTHSVLSMVLDPELELADLAFPPPSANASSLKMQDKELRAVFLRLFAQL
LQGYRWCLHMVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVLEGMAFAGFVSERGVPYRP
TDLFDELVAHEVARMRADENHPQRVLRHVKELAEQLYKNENPYPAVAMHKVQKPGEASHL
RRAPRPFPRLDEGVVQWIVDQATAKMQGAPPAVKAERRTTVPSGPPMTAILERSSGLHGN
SARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARRCLTQELHLHVQQNRAVLDH
QQFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRVSAGAAPGVXSTPQFWEAMFYG
DVQTHIRALYLEPAEDRDHLQQGGELSAREDERSALDVASEQRRLWPTLSREKQQELVQK
EESTVFSQAIHYANRMSYLLLPLDSSKSRLLRERAGLGDLESASNSLVTNSMAGSVAESY
DTESGFEDAETCDVAGAVVRFINRFVDKVCTESGVTSDHLKGLHVMVPDIVQMHIETRAA
TLVPEQPKLLRPRLLPGEECVLDGLRVYLLPDGREEGAGGSGGGPALLPAEGAVFLTTYR
VIFTGMPTDPLVGEQVVVRSFPVAALTKEKRISVQTPVDQLLQDGLQLRSCTFQLLKMAF
DEEVGSDSAELFRKQLHKLRYPPDIRGTFAFTLGSAHTPGRPPRATKDKGPSLRTLSRNL
VKNAKRTIGRQYVTRKKYNPPSWEQRGQPPPDDQEDEISVSEELEPSTLTPSSALKPSDR
MTMSSLVERACCRDYQRLGLGTLSSSLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSV
QDNALQRVSRCYRQNRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFKAQNAPSPGQSQAD
SGSLEQEKYLQAVVSSMPRYADASGRNTLSGFSSTHVGSHVAPTPDALGCTALSNPMAAS
ASRRTTPRGKWGSVRASGRSGGLGVDVGSRLAGRDMLTPPQANGAPPDPGFLRPQRAALY
IIGDKAQLKGVRPDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPAAEPGPASFLRS
LEDSEWLTQIHKLLQVSVLVVELLDSGSSVLVSLEDGWDITTQVVSLVQLLSDPFYRTLE
GFRLLVEKEWLSFGHRFSHRGAHTLAGQSSGLTPVFLQFLDCVHQVYLQFPMEFEFSPFY
LKFLGYHHASRRFRTFLLDSDYERIELGLLYEEKGERRGQQACRSVWEYVDRLSKRTPVF
YNYMYAPEDTEVLRPYSNVSNLKVWDFYTEETLAEGPPYDWELAQGPPEPPEEERPDGGA
PQSRRRVVWPCYDSRPRAQPDAISRLLEELQRLETELGRPPERWKDTWDRVKAAQRLEGR
PDGRGTPSSLLVSSVPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTASGSRQAARRST
STLYSQFQTAESENRSYEGTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVI
DLAEVEAVAPGTPTMGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDQIQSCLSDA
Download sequence
Identical sequences ENSFCAP00000004093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]