SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004096 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004096
Domain Number 1 Region: 201-352
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-32
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 90-192
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-21
Family Second domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 14-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-18
Family First domain of FERM 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004096   Gene: ENSFCAG00000004437   Transcript: ENSFCAT00000004438
Sequence length 1019
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:12529582:12662415:-1 gene:ENSFCAG00000004437 transcript:ENSFCAT00000004438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDQGERCIDHTASTERQLEVSLQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNW
LQLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVD
SEVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKL
NGQTRGQAIVNFQMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRK
IFQWRQLENLYFREKKFSVEVHDPRSHRASVTRRTFGHSGIAVHTWYACPALIKSIWAMA
ISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLS
SGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPIEYPLDP
GEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKK
LKKQRKTSYLNALRKLQEIENAINENRIKSGKKPTQRASLIIADGNIASEDSSLSDALVL
EDEDSQVTSTLSPLQSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHGSDYDKSPIKPKMW
SESSLDEPYEKVKKRSSHGHSSSHKRFPSTGSCAEAGGGSSSLQNSPIRSLPHWNSQSSM
PSTPDLRVRSPHYVHSTRSVDLSPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFY
TEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSGERGRGWGGGEPPDI
LRSLVSESWAVRRLRLGAFGSPLLHALPSQPWLWGTEISETVGGRGAAPPTLPSGLGQVA
PGSASTDIGEAPCDVAPGLFQSKAHLYPGEETLTRVAPSRGTLVPAHLGRGGGVGWGAGR
RLCLDYRERKGRQLRHNKRHIGQMTGSREENKSDSGNHERNHISGKKLLHWSCLTPPFLH
HPSAAALPQSQRSSTPSSEIGVTPPSSPHHILTWQTGEATENSPIMDGSESPTHQSTDD
Download sequence
Identical sequences ENSFCAP00000004096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]