SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004143 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004143
Domain Number 1 Region: 48-409
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.27e-66
Family Ankyrin repeat 0.0000166
Further Details:      
 
Domain Number 2 Region: 524-579
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000209
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004143   Gene: ENSFCAG00000004489   Transcript: ENSFCAT00000004489
Sequence length 588
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:140984741:141005614:1 gene:ENSFCAG00000004489 transcript:ENSFCAT00000004489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTNDDPDEDHLTSYDIQLSIQESIEASKSVFSSERFVPLSDQNRKLVEAIKQGHILELQ
EYVKYKHALDEADEKGWFPLHEAVVQPIQQILEVVLDASYQTLWEFKTSEGETPLTLAVK
AGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYDMVFTLLKHNASLDQPCIKRWSA
MHEAAKQGRKDIIALLLNHGGNVHLRDGFGVTPLGVAAEYGHCDVLEHLIHRGGDVFALA
DDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKYLIPITS
KNAIQKSGLTPIHSAADGQNVQCLELLIENGFDVNTLLADHISESYDDERKTALYFAVSN
NDIQCTEVLLAAGADPNLDPLNCLLVAVRANNHEIVRLLLSHGANVNCYFMRVNDTRFPS
AIQYALNDEVMLRLLLNNGYQVEMCFDCMHGNIFGNSFVWSEIEEEVLPGWTSCVIKDNP
FCEFITVPWMKHLVGSVIRVLIDYMDYIPLCAKLKSALQVQREWPEIRQILENPCSLKHL
CRLKIRRLMGLQRLCQPASMEKLPLPPTIRRYILFKEYDLYGQELKLP
Download sequence
Identical sequences ENSFCAP00000004143 XP_003983038.1.62641 XP_014922784.1.86478 XP_019681311.1.62641 XP_019681312.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]