SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004157 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004157
Domain Number 1 Region: 8-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 690-700,821-862
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000288
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004157   Gene: ENSFCAG00000004503   Transcript: ENSFCAT00000004504
Sequence length 1165
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:33288378:33298602:-1 gene:ENSFCAG00000004503 transcript:ENSFCAT00000004504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSDTTSTTTSMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQR
LIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGIGSASATHGGGPPPGTR
GPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQT
LLSRMECRGGPQAQHSQPPPQTPTVAPESVALSSQASEPVESEVPPREPMEAEEVEERAP
AQSPELTPSGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGA
AATTDYNNNQEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSH
YTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTSNAEAAPPGPGQASSLAPTSTTVESS
TEGVPPPGPAPPPTTSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPG
HGQTLGSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAGQQVPGFPTAPTRVVIARP
TPPQARPSHPGGPPISGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPA
PATASASAGTTNTATTAGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPGMA
SPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSP
GGLGLESLSPEFFTSVVQGVLNSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGAL
GFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPGNIRTAT
HTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLEL
CNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEH
MPVGPDAILRYVRRVGDPPQPLPEEPMEVQGSERTSPEPQRENASPAPGTTAEEAMSRGP
PPAPEGGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMP
AKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRADIQ
KRLQEDPNYSPQRFPNAHRAFADDP
Download sequence
Identical sequences M3W2A9
XP_006931614.1.62641 XP_019685913.1.62641 ENSFCAP00000004157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]