SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004216 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004216
Domain Number 1 Region: 256-318
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000179
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000839
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004216   Gene: ENSFCAG00000004565   Transcript: ENSFCAT00000004565
Sequence length 487
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:39100489:39134138:1 gene:ENSFCAG00000004565 transcript:ENSFCAT00000004565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAASGHEIIVQYFLNHGVRVDTRDHSGATARMLAKQYGHMKIVGLIDAHSPTLPKNLY
RSPEKFEDLSSSDESCPVPQRQRPCRKKGLSIHEGPRALARITAIGLGGKMQQACCEQVP
PRGYVTFNSSDENPLEAGGLCYRDVTSPINDRDVESSSSSSREEHAFCANLGVARRSSSS
EGLARAPGVSSEASLESNEDSDHACQSSVRKQTKSYMKTKNRYSNSDGQWPASTGPAGAA
CSPASVSQTERSLCSGPQDLATLLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGIT
LFGPKRKMTSAIARWHSSARPPSDALELAYADRLEAEMQELAIQLHKRCEEVEAMRGQVS
QEQELRAVVESCLLEQDGARKDVHAQLQETWALARDAALVLDQLRACQAELSARVKQEES
TRGLPQGPALPTADSKGWQASLQALSLPELSGALEDRVQEMGRVLCSVTQSLEKLQVLNG
KENWREP
Download sequence
Identical sequences ENSFCAP00000004216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]