SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004223 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004223
Domain Number 1 Region: 1635-1734
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-19
Family Plakin repeat 0.0074
Further Details:      
 
Domain Number 2 Region: 247-372,562-590
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000114
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 3 Region: 674-785,813-840
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000892
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 4 Region: 73-191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004223
Domain Number - Region: 550-681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00234
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004223   Gene: ENSFCAG00000004571   Transcript: ENSFCAT00000004572
Sequence length 1735
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:38939055:38962595:1 gene:ENSFCAG00000004571 transcript:ENSFCAT00000004572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SISNKELSDLIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDTTLQKVSDSEK
LLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYNLVVKEVDPQVNWAA
LVDEKLDKLSSQNFGTDLPLVDHQVEHHNIFHNEVKAIGPHLAKDGGKENSDLQAKYQKL
LAASQARQQHLSTLRDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINR
NLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMED
YHEFHRDVKAAQELLCKVDSDLNQKYSPDFKDQYQIELLLRELDDQEKALDKYEHVVRGL
QKRGQQVVPLKYRRETPLKPIPVEALCDFEGDQGLISRGYSYTLQSNNGESWDLTDSTGN
KLSAPAVCFVIPPTDPEALALAESHSLGSQYRSVRQKAARSRNALQQRHEVLKAESPGDA
SDQQGRHLLAGLDKVARDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLRI
EPEKARSTAECQDFMQALPGSGSVPLLRTRVDDTNRKYERLVQLLDLAQEKVDVANRLEM
SLRQGWEALAEYETRLTQDDTVPEGGRALDSKRQELVALASALQAQESLLSDVEQNLQAA
KRCSSSLASRFQEHCPDLERQEAEAHRLAQRSENLRQQVELRAQSLQNARAAYDDYRSGY
DHMLQFLSHIPSYEPQETDTLSQMETKLKNQKNLLDEIARREEEVQKVCTSSQQYQQAVK
DYELEAEKLRSLLDLENGSHVTKRARLQSPAAKVREEEAALAAKFTEVNAINRQRLHNLE
FALSLLRQQPEVGASHETPQGSTPGSAVEETWKVQKELEEETERRQQLEKEVKSAQEEIQ
TLQNQSPQEAVVQKEVLKKVPDPALEESFQQMQRTLVEERHKNQLLQEELEGLRLRLRAL
EQETRDGGQEYVVKEVLRIEPDRAQADEVLKLREELEELRRQKGTREAEAALLQQRIAAL
AEEKERAQERVTEKEVVKLQNDPQLEAEYRQLQEARQREGKLREEHEEELSFLQDKLKRL
EKERAMAEGKITVKEVLKVERDVATEREVGDLKRQCEDEAAKARTNQREKTELLRKIWAL
EEENARVLVQEKVREIVRPDPEAEREVANLRLELVEQERKYRGAEEQLKSYQSELEALRR
RGPQVEVKEVTKEVIKYKTDPEMEKELRRLREEIVDKTRLIERCDLEIYQLKQEIQSLKD
TKPQVQTKEVVQEILQFQEDPQTKEEVESLRARLSEEQKKQVDLQRERASQEEKIRQKEE
ELSQVKEKVVQQEVVRYEEEPSLRAEVNAFTESIEVELRQIDSLRGELRRLQRRRAELER
QLEELDRERQARREAELEVQRLKQRLADLEKEEAEAREKVTLKQKVVLQQDPQQAREHSL
LKVQLEEERHRRQVLESELETLKQQLVNLEKMEVKEKVVFSESVQVEKGDTEQEIQKLRS
SLEEESRSKRELDAEVSRLEAKLSELEFCNSKSSKELDFLREENHRLQLERQSLQLETRR
LQSEMEMAATETRDLRTTSTADSGTNLDSRLWSLERELDDLKRLSKDKDLEIDELQKRLG
SVAVKREQRENHLRRSIVVIDPDTGRELSPEEARRAGLIDWNMFVKLRSQECDWEEISVK
GPSGESSVIHDRKSGRKFSIEEALQKGRLTPAQYERYVNKDMSIQELAVLVSGQK
Download sequence
Identical sequences ENSFCAP00000004223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]