SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004334 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004334
Domain Number 1 Region: 423-723
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.6e-73
Family Protein kinases, catalytic subunit 0.00000043
Further Details:      
 
Domain Number 2 Region: 261-381
Classification Level Classification E-value
Superfamily Kringle-like 2.15e-34
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 47-135
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-22
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004334
Domain Number - Region: 153-240
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004334   Gene: ENSFCAG00000004691   Transcript: ENSFCAT00000004692
Sequence length 921
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:4507932:4649018:-1 gene:ENSFCAG00000004691 transcript:ENSFCAT00000004692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSADAEPCLWEMEVPDPNDPLGELDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAIL
HCKVAGNPPPTVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGV
KTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGE
IENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLES
DLCRQEYTIARSNPLILMRLQLPKCEALPLPESPDAANCMRIGIPAERLGRYHQCYNGSG
TDYRGTATTTKSGHQCQPWALQLPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQN
KNVRMELCDVPPCSPQDSSRMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQR
RQLMASPSQDVEMPLINQHKQAKLKEISLSSVRFMEELGEDRFGKVYKGHLFGPTPGEQS
QAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNIVCLLGVVTKDQPLSMVFSYCSHGDL
HEFLVMRSPHSDVGSTDDDRTVKSTLEPPDFVHVAAQIASGMEYLSSHHVVHKDLATRNV
LVYDKLSVKISDLGLFREVYSADYYKLMGSALLPVRWMSPEAIVYGKFSVDSDIWSYGVV
LWEVFSYGLQPYCGHANQDVVEMIRSRQVLPCPDDCPAWVYALMLECWNEFPSRRPRFKD
IHGRLRAWGNLSAYNSSAQTSGASNATQTSSLSTSPVSNVSNARYGGPKPKAQPFPQPPF
MPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPAQVVPKPGS
HHSGSGSTSTGYVTTAPSNTSMADRAALLSEATEDAQNTPEDAAQSPVQEAEEEDGSVPE
TELLGDNDTLQMGEAEGQLEA
Download sequence
Identical sequences A0A2I2UXP2
ENSFCAP00000004334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]