SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004396 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004396
Domain Number 1 Region: 49-310
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.63e-31
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 365-413
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000314
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004396   Gene: ENSFCAG00000004756   Transcript: ENSFCAT00000004757
Sequence length 421
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:89824314:89829652:-1 gene:ENSFCAG00000004756 transcript:ENSFCAT00000004757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQEPLDGSSYVASEESRILVLTELLERKA
HSPFYQEGVSNALLKMAELGLTRAADVLLRNGANLNFEDPVTYYTALHIAVLRNQPDMVE
LLVRHGADINRRDRVSESSPLDLASEEPERLPCLQRLLDLGADVNAADKHGKTALLHALA
SSDGVQIYNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGETVGGDKDEAQMISRFCF
QVTKLLLAHGADPSECPAHESLTHICLKSFKLHFPLLRFLLESGAAYNCSLHGASCWSGF
HIIFERLCSHPGCAEDESHVDLLRKAETVLDLMVTNSQKLQLPENFDIHPVGSLAEKIQA
LHFSLRQLESYPPSLKHLCRVYIRLYLQPWPVDVKVKALPLPDRLKWYLLSEHSGTTEED
I
Download sequence
Identical sequences ENSFCAP00000004396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]