SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004410 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004410
Domain Number 1 Region: 845-1153
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000997
Further Details:      
 
Domain Number 2 Region: 1116-1413
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000173
Further Details:      
 
Domain Number 3 Region: 3-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-37
Family MAM domain 0.000000552
Further Details:      
 
Domain Number 4 Region: 363-557
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 260-400
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000225
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 6 Region: 165-268
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000235
Family I set domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004410   Gene: ENSFCAG00000004770   Transcript: ENSFCAT00000004771
Sequence length 1414
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:17293514:18075929:1 gene:ENSFCAG00000004770 transcript:ENSFCAT00000004771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPMLDPAVPTGSFMMVNSSGRASGQK
AHLLLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSGVVTEGWV
KAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQ
NATFQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSATVSVADTAQRSVSKYRC
VIRSDGGSGVSNYAELIVKEPPTPIAPPELLAVGATYLWIKPNANSIIGDGPIILKEVEY
RTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRVLLTRPGEGGTGPPGPPLTTRTKCADPV
HGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHY
TLRGLRPFMTIRLRLLLSNPEGRVESEELVVQTEEDVPGAVPLESIQGGPFEEKIYIQWK
PPNETNGVITLYEINYKAVGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGTTYSFTIK
ASTAKGFGPPVTTRIATKISAPSMPEYDTDTPLNETDTTITVMLKPAQSRGAPVSVYQLV
VKEERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGDNKTY
NGYWNPPLSPLKSYSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKM
AGVIAGLLMFIIILLGVMLTIKRRRNAYSYSYYLKLAKKQKETQSGAQREMGPVASADKP
TTKLSASHNDEGFSSSSQDVNGFTDGSRGELSQPTLTIQTHPYRACDPVEMSYPRDQFQP
AIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHS
RVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVT
NLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHF
TSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENE
GVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLD
PQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGE
PSNYVNAALMDSHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVMLNEMDTAQLCMQY
WPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTP
PSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVF
HIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF
Download sequence
Identical sequences ENSFCAP00000004410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]