SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004445 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000004445
Domain Number - Region: 808-906
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0672
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004445   Gene: ENSFCAG00000004809   Transcript: ENSFCAT00000004810
Sequence length 1182
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:21330957:21359590:1 gene:ENSFCAG00000004809 transcript:ENSFCAT00000004810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPPSLDTAIQHALAGLYPPFEATAPTILGQVFRLLDSDFQGDGLSFLLDFLIPAKRLCE
QVREAACAPYSHCLFLHEGWPLCLRDEVVVHLAPLNPLLLRQGDFYLQVEPQEEQSVCIM
VKCLSLDLRTVDAKPVPASSYPTLFTRTWLEAINSDFEGSPLHNCLVASEDGIASVPWTK
IANPEFVDDRPQAVNVLSRAWGSLELEALDLSSPPEPHQPRPSGSQGLLARSLAKGKGRT
YGNKYPGLIKVEQARPGEVAFRMDDVASQDLEGDYVALLESRGGPPSREVETSSGCPLGA
LEEPSRTKEILLSQRMPPLSGARGGPSLEKWAGEKPASSEEEPCRLGSRRKVNYKVNAST
QDSEPQPQEPYLRVLEEPPPCASGLEAGGSSKMQEPLGSPENMAQLRPAPVRASSLHLCS
ASPPAAPAPETKLEERAKQGQGSLPKPETGPSQNTSSSTSPTSGLRFSLLKGQRQAPGPP
EKASLQPDRPWKVLRSPSSPTTNRAKSVGKAGKTQTETSGPAADSGPRTGEKAGFPEVPP
EREPPLDEEPPGPEPRIGALSVEILQSRMACLPGGRDRAGRRLLLVSTTEGSWEAPWCTA
SEVTKLLSYLCTVPRPEDKTKGLAVMIDSRKQPPHPGLVSALQATQALAPASIRAVFYLG
EKEAALQLETLPDVQVEVVTSLRALSHHVDPGQLPTALEGPFPYCHSEWVQFFQKLDPFL
ADLHQVSSLLKASIKQFEKSDLPGGVQEASRCLSKSKELMETVLRDPGLLGLQREGGATL
ARLRQEASRLDFNPDVRSHLAEAVAWYGLVDEQLHVLVTASNHLLGALELRVRLGRLEAA
IHQVSNWMEQEGSRCLQMLTPKDRSLETVQKAHAEFEDFFLQAAAQYRRGLELSKQAAQL
GAAAGGAELPELVAFTSTQRAFQAKLTHFYMAAERQRTDLETLLRLHHFCKKITWFHVDC
QDLMRQLRLGKTQRASPGDQRLVHRYLRRLASEFPAEKLTAMGLQVASLSQEGPGQALWE
EARVRHEEIQTLLKRALAHCPCPAGPAAHSAHPELRKAVAEGRGLNAAVASRGRGRRGLP
LRDSLGLDRPPNSYWPRAPREGQNGSFQAGLLAQEAGQAGEADEGKDPREPFDPASEPLL
APLGSWQQSHTPHPAGGSFSSEGTDSQTSPEDSPQTSPLHLS
Download sequence
Identical sequences ENSFCAP00000004445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]