SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004485 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004485
Domain Number 1 Region: 76-277
Classification Level Classification E-value
Superfamily Fibronectin type III 2.69e-22
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 336-546
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000116
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 3 Region: 23-70
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000353
Family Elafin-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004485   Gene: ENSFCAG00000004854   Transcript: ENSFCAT00000004856
Sequence length 574
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:5336558:5408176:-1 gene:ENSFCAG00000004854 transcript:ENSFCAT00000004856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLFPKKNYECLTSCEFLKYILAVKQGDCPAPEKASGFAAACVESCEADNECSGVKKCCSN
GCGHTCQVPKTLYKGVPLKPRKELRFTELQSGQLEIKWSSKFNISIEPVIYVVQRRWNYG
IHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAGVNVHGTRGFTAPSKHFRSSKD
PSAPPAPANLRLANSTVNSDGTVTVAIVWDLPEEPDIPVHHYKVFWSWTVSTKSLVPTKK
KRRKTTDGSHNSVILDRLQPDSGYTVELQAIAYWGQTRLKGAKASLHFTPARSASHKEQV
GKPRKSVVHIQPSFQRRRPSRLLEIGAPFYQDNQLQVKVYWKKTEDLSVDRYHVQWLPEV
CAHNRSAGAETSSGITQENYIILQDLSFSCKYKVTVQPIRPKGRLKAETVFFTTPPCSAL
KGKSHRHMSCPGEAGHVPAKVLAKPENLSASFVVQDVNITGHFSWKMAKANLYQPMTGFQ
VTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTAGGEGPAT
IKTFRTPDLTLPSVHRPHLKHRHPHHYKASPERY
Download sequence
Identical sequences ENSFCAP00000004485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]