SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004569 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004569
Domain Number 1 Region: 428-443,491-862
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.31e-99
Family Formin homology 2 domain (FH2 domain) 0.00000932
Further Details:      
 
Domain Number 2 Region: 8-327
Classification Level Classification E-value
Superfamily ARM repeat 4.61e-79
Family Diap1 N-terninal region-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004569   Gene: ENSFCAG00000004939   Transcript: ENSFCAT00000004941
Sequence length 1155
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:147434595:147448111:1 gene:ENSFCAG00000004939 transcript:ENSFCAT00000004941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTVREGAQRKWAALKEKLGAQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLESS
DGGWMVQFLEQSGLDLLLEALARLSGRGVARIADALLQLTCISCVRAVLNSQRGIEYILS
NQAYVRQLSLALDTSNVMVKKQVFELLAALCIYSPEGHMLTLDALDHYKTVCSQQYRFSV
IMNELSDSDNVPYVVTLLSVINAIILGPEDLRTRTQLRGEFTGLQLLDVLTRLRDLEDAD
LLIQLEAFEEAKAEDAEELLRICGGVDMNNHQEVFTSVFHKVSCSPASAQLLSVLQGLLY
LEPTLPSSQLLWEALENLVNRAVLLASDGEQVGPSGHGAHSPHPPPALTPPPPPMHGQQG
LRPLREGSRPLPEGSGHACPTSPYPPPLALGPDPGTPSSVQECTLEEMMERLLSVKLPSP
LPGTGCPPPPPPPGLDGGPPPPPPLPGTSGPSAAGGVEEVIVAHVGPSLGSSAWVPSHRC
VHAPTVRMKKLNWQKLPSNVAQEHSSMWASLSSLGAEVVEPDFSSIERLFCFPEAKPKEQ
VAAPARKEPKEITFLDSKKSLNLNIFLKQFRCSNEDVTAMIRAGDTTKFDVEVLKQLLKL
LPEKHEVENLRAFSEDRTKLANADQFYLLLLGIPCYQLRVECMLLCEGTAVVLDVVQPKA
QLVLAACDSLLTSHQLPVFCRLILKIGNFLNYGSHTGDADGFKISTLLKLTETKSQQSRV
TLLHHVLEEVEKNHPDLLQLPRDLEQPSQAAGINLELIRSESSTNLKKLLEMERKVSSCI
PEVQEQYAQRLQASIEASRALDEVFQAIEQKKLQLASYLCEDAQQLSLEDTFSTMKAFRN
LFLRALKDNKDRKEQAAKAERRKQQLAEEEACRPRGEDGKPVRRGVGKQEDVCVIDALLA
DIRKGFQLRKTARGRGDAEGGSKAAAGDPLRDKAPAATRDPAGDTSHPASEPHGRDRVDA
TAPGPKPTADPSEEEGPGPLGRRSSWYTDASDFLAAEAPQAPQPSAGAWPVVLGGAQALK
PLRLSGDKPPGATGSSQDAEDPAGPRDACLAEADSTVRRPEATGPRGHGATGPGVAGDGD
QEDTAPDSALDTSLDRSFSEDAAMDSSGSSTLPRTRERASKGTGKRRKKRPSRNQEAEVA
PDSDDNKTKRLCVIQ
Download sequence
Identical sequences ENSFCAP00000004569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]