SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004600 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004600
Domain Number 1 Region: 71-182
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-23
Family PDZ domain 0.0043
Further Details:      
 
Domain Number 2 Region: 214-286
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.0000938
Further Details:      
 
Domain Number 3 Region: 743-843
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-18
Family PDZ domain 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004600   Gene: ENSFCAG00000004971   Transcript: ENSFCAT00000004972
Sequence length 910
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:75647937:75695374:-1 gene:ENSFCAG00000004971 transcript:ENSFCAT00000004972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVVVLVGDLKLVINEPSRLPLFD
AIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKG
GQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIKVRHIGLIPVKSSPDEPL
KWQYVDQFVSESEGGRSSLGFPGSRENKEKKVFISLVGSRGLGCSISSGPIQKPGIFISN
VKPGSLSAEVGLETGDQIVEVNGIDFSNLDHKEAVNVLKSSRSLTISIVAGAGRELFLTD
RERLEEARQRELQRQELLMQKRLAMESNKILQEQQEMERQRKKEIAQKAAEENERYRKEM
EQIVEEEEKFKKQWEEDWGSKEQLLSSKTITAEVHPIPLRKPKSFGWFYRYDGKFPTIRK
KGKDKKKAKYDSLQELRKNKKELEFEQKLYKEKEEMLEKEKQLKINRLAQEVSETEREDL
EESEKIQYWVERLCQTRLEQISSADNEISEVTDDTGPPPPPPSVSPLVPPLRRFAGGLHL
HTTDLDDIPLDMFYYPPKTTSALPVMPHPPPSNPSPKIPAPPVLPSSGRVSASSSPWVQR
TPPPIPIPPPPSIPTQDLTPTRPLPSALEEALGNHPFRAGDTGNPTEDWEAKNHSGKPTN
SPVPERSFPPTPKTFCPSPQPPRGPGVSTISKPVMVHQEPNFIYRPAVKSEVLPQEMLKR
MVVYQTAFRQDFRKYEEDFDPYSMFTPEQIIGKDVRLLRIKKEGSLDLALEGGVDSPVGK
VVVSAVYEGGAAERHGGIVKGDEVMAINGKIVTDYTLAEAEATLQKAWSQGDWIDLVVAV
CPPKEYDDELSSLPSSAAESPQPVQKFLEDRAPVHRHRFLLQLEPGDLLLKSRRRNQIHP
LKPASSGLTL
Download sequence
Identical sequences ENSFCAP00000004600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]