SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004694 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004694
Domain Number 1 Region: 42-192
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-40
Family Dual specificity phosphatase-like 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004694   Gene: ENSFCAG00000005072   Transcript: ENSFCAT00000005069
Sequence length 199
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:37911589:37915185:-1 gene:ENSFCAG00000005072 transcript:ENSFCAT00000005069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMNSLQKQDLRRPKIHGAVRVSPYQPPTLASLQRLLWVRRAAMLSHIDEVWPNLFLGDAY
AARDKNKLTQLGITHVVNVAAGKFQVDTGAKFYRGMPLEYYGIEADDNPFFDLSVYFLPV
ARYIRTALSVPKGRVLVHCAMGVSRSATVVLAFLMICENMTLVEAIQTVQAHRDICPNSG
FLQQLQVLDNRLGRETGRL
Download sequence
Identical sequences ENSFCAP00000004694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]