SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004723 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004723
Domain Number 1 Region: 616-877
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-81
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 283-385
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 501-602
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 4 Region: 390-490
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 170-273
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 102-173
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-16
Family Kringle modules 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004723   Gene: ENSFCAG00000005100   Transcript: ENSFCAT00000005100
Sequence length 878
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:105687090:105763622:1 gene:ENSFCAG00000005100 transcript:ENSFCAT00000005100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVVALVLGALPEVVGFDLVLRYPLHHRYRHSLPPGPPHPYYLPTQQRQQRTPLSP
SLPRVPRVPRPPPALHAQRLHALHAGRTPGPHPGDCPAGEPWVNVTDFGAPCLLWAEVPP
FLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGNAHGKVDWGYCDCRHGSVRLRGGKN
EFEGTVEIYANGVWGTVCSSHWDDSDASVICHQLQQGGKGVAKQTPFSGLGLIPIYWSNV
RCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPAFPVIRLVGGSSAREGRVELYH
AGQWGTVCDDQWDEADAEVICRQLGLSGIAKAWNQAYFGEGSGPIMLDEVRCTGNELSIE
QCPKSSWGEHNCDHKEDAGVSCTPLTDGVIRLGGGKGSHEGRLEVYYRGRWGTVCDDGWT
ELNTYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETSFTQCSRRQWGKHDCSH
REDVGITCYPGGNGHRLSLGFPIRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDATVI
CRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGV
ICDYFGKKATGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDG
RLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHRE
YRPDSSDYDIALVRLEGPEEQCVRFSSHVLPACLPLRRERPQKTASNCYITGWGDTGRAY
SRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCVRSGES
WVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences M3W3G7
ENSFCAP00000004723 XP_003985107.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]