SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004780 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000004780
Domain Number - Region: 51-64
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0523
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004780   Gene: ENSFCAG00000005155   Transcript: ENSFCAT00000005158
Sequence length 868
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:92631652:92654593:1 gene:ENSFCAG00000005155 transcript:ENSFCAT00000005158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIGEGSWGKSRESCSTPTVRELSRGCGAAKMEPAAGGPGPLIMNNKQPQPPPPPPPVTA
QPPPGAPRAGGGLLPGGKAREFNRNQRKDSEGYSESPDLEFEYADTDKWAAELSELYSYT
EGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEVTAREKRLKVARAIL
YVAQGTFGECSSEAEVQSWMRYNIFLLLEVGTFNALVELLNMEIDNSAACSSAVRKPAIS
LADSTDLRVLLNIMYLIVETVHQECEGDKAEWRTMRQTFRAELGSPLYNNEPFAIMLFGM
VTKFCSGHAPHFPMKKVLLLLWKTVLCTLGGFEELQSMKAEKRTVLGLPPLPEDSIKVIR
NMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEEEENDDDN
SLEGETFPLERDEVMPPPLQHPQTDRLTCPKGLPWAPKVREKDIEMFLESSRSKFIGYTL
GSDTNTVVGLPRPIHESIKTLKQHKYTSIAEVQAQMEEEYLRSPLSGGEEEVEQVPAETL
YQGLLPSLPQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPTTVLQSMKLGVDVNR
HKEVIVKAISAVLLLLLKHFKLNHVYQFEYMAQHLVFANCIPLILKFFNQNIMSYITAKN
SISVLDYPHCVVHELPELTAESLEAGDNNQFCWRNLFSCINLLRILNKLTKWKHSRTMML
VVFKSAPILKRALKVKQAMMQLYVLKLLKVQTKYLGRQWRKSNMKTMSAIYQKVRHRLND
DWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDL
PEDFQMNYDLWLEREVFSKPISWEELLQ
Download sequence
Identical sequences M3W3K7
ENSFCAP00000004780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]