SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004858 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004858
Domain Number 1 Region: 542-552,589-961
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.09e-105
Family Formin homology 2 domain (FH2 domain) 0.0000264
Further Details:      
 
Domain Number 2 Region: 1-114,177-410
Classification Level Classification E-value
Superfamily ARM repeat 1.97e-99
Family Diap1 N-terninal region-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004858   Gene: ENSFCAG00000005239   Transcript: ENSFCAT00000005240
Sequence length 1052
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:143094309:143223106:1 gene:ENSFCAG00000005239 transcript:ENSFCAT00000005240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQ
ESTQVLRELEISLRTNHIGWVREFLNEENRGLDVLVEYLSFAQYAVTFDFESVESTVESS
VDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDV
HVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHE
IILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQ
YEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEEN
ISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEA
IQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSTGSEVAVGNFVGPAMGVA
SSGPLPPPPPPLPPSSDTPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAET
VPAPPLPPPPPPSAPPLPGTSSPTVVFNSGLAAVKIKKPIKTKFRMPVFNWVALKPNQIN
GTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAIDLSSSKQKITQKGSNKVTLLEANRAK
NLAITLRKAGKTADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVFRLYERERKPLE
NLSDEDRFMMQFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHSIIAASVSIKSSQKLKK
ILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSL
FYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMHDHNTLLKEFILNNEGKLKKL
QDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALME
KLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITDLRN
QPYRRADAVRRSVRRRFDDQNLRSVNGAEITM
Download sequence
Identical sequences ENSFCAP00000004858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]