SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004913 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004913
Domain Number 1 Region: 226-335
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-27
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 340-453
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-25
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1067-1167
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-22
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 4 Region: 676-774
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-22
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 119-225
Classification Level Classification E-value
Superfamily PDZ domain-like 5.99e-22
Family PDZ domain 0.006
Further Details:      
 
Domain Number 6 Region: 5-64
Classification Level Classification E-value
Superfamily L27 domain 9.42e-22
Family L27 domain 0.0000656
Further Details:      
 
Domain Number 7 Region: 572-641
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-16
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004913   Gene: ENSFCAG00000005299   Transcript: ENSFCAT00000005300
Sequence length 1223
Comment pep:novel chromosome:Felis_catus_6.2:C1:49657449:49803956:1 gene:ENSFCAG00000005299 transcript:ENSFCAT00000005300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPENPAPDKLQVLQVLDRLKMKLQEKGDTSQNEKLSLFYETLKSPLFNQILTLQQSIKQL
RGQLSHIPSDCSANFDFSRKGLLVFTDGAITNGNAQRPSNNLTASGLFPWTPNLGNEDFN
SVIQQMAQGRQIEYIEIERPSTGGLGFSVVALRSQNLGEVDIFVKEVQPGSIADRDQRLR
ENDQILAINHTPLDQNVSHQQAIALLQQTTGSLRLVVAREPGHMKSSTSTSLTDTTVLET
VHWGHIEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTD
VQGMTSEQVAQVLRNCGNSVRMLVARDPVGEISETPPPPAALPVALPAVANRSPSVDSSL
FETYDVELIKKDGQSLGIRIVGYIGTPHTGEASGIYVKSIIPGSAAYHNGQIQVNDKIIA
VDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTFSSASPHEWPSDRGTVIESSEIPALY
STGAVETETNLDGGDEETEEKMGNLKALEKLAKPDFNPEKVPDSLENELKSRWENLLGPD
YEVMVATLDTQIADDAELQKYSKLLPIHTLRLGMEVDSFDGHHYISSIVPGGPVDTLKLL
QPEDELLEVNGVQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTTEASLPK
IEADHSVDVHTEDDDDGELALWSPEVKIVELVKDHKGLGFSILDYQDPLDPTRSVIVIRS
LVADGVAERAGELLPGDRLVSVNEYSLENTTLAEAVEVLKAVPPGIVRLGICKPLVEDDK
EGESHYILHSNRNEDKTELSETIHDINSSLILEAPQGFRDEPYYQEELVDEPFLDLGKTF
QSQQKEIDNSKEAWEMREFLTPRLQEMGEEREMLVDEEYELYQDHFQSMDLYASSHLQEA
APVPSVKELHFGTQWLHDSEPPELQEARSMMSIYSQETQQYGYSAENMMKENFGIDSLPS
MPSSEGSSQQGRFDDLENLNSLTQSSLDLALPQSDTLQGSEIICDFLIRQSSKEMQECLQ
LGQMMPRTRVVSKTSAYTGTLSSRYTTDACELPEREEGEGEETPNFSHWGPPRIVEIFRE
PNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQ
NASHREAVEAIKNAGNPVVFVVQSLSSTPRVVPTVHNKANIIASNQDQNTEEKKEKRPGT
APPPMKLPPPYKAPSDDSDENEE
Download sequence
Identical sequences ENSFCAP00000004913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]