SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004936 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004936
Domain Number 1 Region: 402-726
Classification Level Classification E-value
Superfamily DNase I-like 2.36e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 15-114
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-26
Family SH2 domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1189-1252
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000314
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004936   Gene: ENSFCAG00000005323   Transcript: ENSFCAT00000005324
Sequence length 1254
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:61873302:62052462:-1 gene:ENSFCAG00000005323 transcript:ENSFCAT00000005324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYQGPGGALXXXAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCVLYQKH
VHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEREREPDP
PDDRDASDGEDEKPPLPPRSGSTSISAPMGPSSPPAAPETPTTPAAESAPNGLSTVSHEY
LKGSYGLDLEAVRGGASNLPHLTRTLATSCRRLHSEVDKVLSGLEILSKVFDQQSSPMVT
RLLQQQNPPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPAPLQPSIRKA
KTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTFTHDRI
RQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHSKQDEPDMI
SVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQENSVGDREWLDL
LRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAV
GVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLSLGDRQLSAFDISLRFTHLFW
FGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYE
RGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGT
FEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKKSFEND
AQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVVALKSM
IGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDEAGAKSKAPS
VSRGSQDPRSGNRKPAPTEASCPLSRLFEEPEKPPPTGRPPAPPRAAPREEPLTSRLKAE
GAPEPEGVAAPPPKNSFNNPAYYVLEGVPHQLLPPEPPSPARTPVPPATKNKVAITVPAP
QLGRHRPPRVGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLTGPVVRGRSGGE
ARGPPPPKAHPRPPLPPGPSPTSTFLGEVASGDDRSCSVLQMAKTLSEVDYAPAGPGRSV
LLPGPLELQPPRGLPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQGGRASGLGEAGMGAW
LRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Download sequence
Identical sequences ENSFCAP00000004936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]