SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005027 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005027
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.88e-38
Family SCAN domain 0.0000532
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005027
Domain Number - Region: 214-257
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0011
Family KRAB domain (Kruppel-associated box) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005027   Gene: ENSFCAG00000005422   Transcript: ENSFCAT00000005424
Sequence length 257
Comment pep:novel chromosome:Felis_catus_6.2:B2:1938279:1942596:-1 gene:ENSFCAG00000005422 transcript:ENSFCAT00000005424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMAGESAESTAWDAQPTENHMGPLVAKTEAGEASAPVRDASPHRGPEHSRRRFRGFRYPE
AEGPREALSRLRELCRQWLSPDIHTKEQILELLVLEQFLTILPAELQAWVRGQHPESGDE
VVVLLEHLQRQLEAPTPQVPGGDQGQELVCREMAALAPSRGSRSAQFQPVRALLKHESLG
SRALPGTVLQGPGLAPGGRCRGDAVVAARLPPEPQGLLKTEDVALAFSSGWAQLDSSRGS
FHGDEGRENPGGLTSPG
Download sequence
Identical sequences ENSFCAP00000005027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]