SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005128 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005128
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-88
Family Calponin-homology domain, CH-domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-32
Family Spectrin repeat 0.000000765
Further Details:      
 
Domain Number 3 Region: 517-638
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-32
Family Spectrin repeat 0.0000043
Further Details:      
 
Domain Number 4 Region: 397-513
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-22
Family Spectrin repeat 0.00000171
Further Details:      
 
Domain Number 5 Region: 642-753
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-20
Family Spectrin repeat 0.00000341
Further Details:      
 
Domain Number 6 Region: 746-878
Classification Level Classification E-value
Superfamily EF-hand 8.27e-20
Family EF-hand modules in multidomain proteins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005128   Gene: ENSFCAG00000005527   Transcript: ENSFCAT00000005530
Sequence length 906
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:110949991:110963006:1 gene:ENSFCAG00000005527 transcript:ENSFCAT00000005530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVMQPEGLGVREGPFAGGGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRK
AGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKL
VSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQ
NFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPRMLDAEDI
VNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELL
EWIRRTIPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRL
SHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHE
TWTRVGKEDMLSQRDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDY
HDAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLD
GAVEDLQDVWLVHSVEETQSLLTAHDQFKATLPEADRERGAILGIQGEIQKICQTYGLRP
SLTNPYINLTPQDINTKWDMVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAVGPWI
QAKVEEVGRLAAGMAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHT
VYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMM
EPDDFRACLISMGYDLRNSTRGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTA
EQVVASFKILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSGAPAGALDYVAFSSAL
YGESDL
Download sequence
Identical sequences ENSFCAP00000005128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]