SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005152 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005152
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-42
Family Dual specificity phosphatase-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005152   Gene: ENSFCAG00000005553   Transcript: ENSFCAT00000005555
Sequence length 221
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:37855556:37877995:-1 gene:ENSFCAG00000005553 transcript:ENSFCAT00000005555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSREPKTSLKNAYPSAKRLLPKVEGEVEAEDYCTPGAFELERLFWKGSPQYTHVNEVWP
QLYIGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYSDMAIEYHGVEADDLPTFD
LSVFFYPAAAFIDAALSHDHSKILVHCVMGRSRSATLVLAYLMIHKNMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRQAKHSDNSEKAGEKEP
Download sequence
Identical sequences ENSFCAP00000005152 XP_006937963.1.62641 XP_006937964.1.62641 XP_019300173.1.44245 XP_019300175.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]