SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005339 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005339
Domain Number 1 Region: 292-402
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000262
Family Second domain of FERM 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005339
Domain Number - Region: 61-255
Classification Level Classification E-value
Superfamily ARM repeat 0.000978
Family Diap1 N-terninal region-like 0.083
Further Details:      
 
Domain Number - Region: 403-454
Classification Level Classification E-value
Superfamily PH domain-like 0.0344
Family Third domain of FERM 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005339   Gene: ENSFCAG00000005750   Transcript: ENSFCAT00000005752
Sequence length 509
Comment pep:novel chromosome:Felis_catus_6.2:E1:57230245:57237346:1 gene:ENSFCAG00000005750 transcript:ENSFCAT00000005752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSEATSSTHSAAYLSLSTESHNYTMQEFALNHFRKPQTLLDQTHGDAKKAMASLVQYTKA
PIQESLISLSDEDANRQAVESFQVLMQFMQDQPKPRGKNESELLYELLRLCREENLRDEI
YCQVIKQVTGHPQQEHCARGWSFLSLLAGFFPPSTTLMPYVTKFLQDSGPSQELAQKSQE
HLQHTVKYGGRRRLPSPAEIQAFLKGQAVRPLLIHLPGGLDYKTSIQTFTVAAEVLEELC
RQIGITDPQEMQEFALFLIKKEGELVRPLWPHEYLNSVLDQDVSLHSRRLSWETQLHFDH
PTYVTTHYKQVLRDYLQGKLLVSPQANAQLARLAALQHRSQTQEDRLSEQDLLAYLPKPL
QRLVSTSTIKNLMEQELKWMQACSSQEAQISFIEAVSQLPLFGYTVYVVLRVSQLALPGP
SLLGLNRQHLILMDPSSQKLYCSVALKDLQRLHLLSPLESNGPPGLELNYGSADNPRTIW
FELVKAQELKHTIAFLKLAQQSTPWPRAS
Download sequence
Identical sequences ENSFCAP00000005339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]