SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005379 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005379
Domain Number 1 Region: 597-676
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000102
Family Canonical RBD 0.014
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005379
Domain Number - Region: 280-305
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000222
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 320-332
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0139
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005379   Gene: ENSFCAG00000005792   Transcript: ENSFCAT00000005795
Sequence length 1060
Comment pep:novel chromosome:Felis_catus_6.2:A1:122234203:122294769:1 gene:ENSFCAG00000005792 transcript:ENSFCAT00000005795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVFKVDLKKVKTFLFSLCLSRCDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQ
KETSGFVDKLFESLYTKNYLPPLEPVKPEPKPPVQEKEEIKEEVFQEPAEEERDGRKKKY
PSPQKTRSESSERRTREKKREDGKWRDYDRYYERNELYREKYDWRRGRSKSRSKSRGLSR
SRSRSRGRSKDRDPSRNVAEHRERSKFKSERNDLESSYVPVSAPPPSSSEQYSSGAQSIP
STVTVIAPAHHSENTTESWSNYYNNHSSSNSFGRNPPPKRRCRDYDERGFCVLGDLCQFD
HGNDPLVVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGPGPGPGPGPGPGPGH
SMRLPVPQGHGQPPPSVVLPIPRPPITQSSLINNRDQPGTSAVPNLAPVGARLPPPLPQN
LLYTVSERQPMYSREHGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPL
VPDTYEPDGYNPEAPSITSSGRSQYRQFFRTQTQRPNLIGLTSGDMDANPRAANIVIQTE
PPVPVSINSNITRVVLEPDSRKRAISGLEGPLTKKPWLGKQGNNSQSKPGFLRKNQYTNT
KLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEA
VLNNRFIRVLWHRENNEQPALQSPTQLLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSP
PSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHTSGNQSDASHVLNQSGGAGEDCQIFS
APGHPKMIYSSSNLKTPSKLCSGSKSHDVQEVLKKKQEAMKLQQDMRKKRQEVLEKQIEC
QKMLISKLEKNKNMKPEERANIMKTLKELGEKISQLKDELKTSSAVSTPSKVKTKTEAQK
ELLDTELDLHKRLSSGEDTTELRKKLSQLQVEAARLGILPVGRGKTMSSQGRGRGRGRGG
RGRGSLNHMVVDHRPKALTVGGFIEEEKDELLQHFSTANQGSKFKDRRLQISWHKAKVPS
VSTETEEEDVKEEETETSDLFLHDDDDEDEDEYESRSWRR
Download sequence
Identical sequences ENSFCAP00000005379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]