SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005399 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005399
Domain Number 1 Region: 275-396
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-24
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 400-439
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000759
Family SOCS box-like 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005399
Domain Number - Region: 73-84
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005399   Gene: ENSFCAG00000005815   Transcript: ENSFCAT00000005816
Sequence length 466
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:39765373:39788716:1 gene:ENSFCAG00000005815 transcript:ENSFCAT00000005816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDALLVLEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPMQDLV
PPGRFSRGEQQQPPPPPPPPGPLRPLAGPSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGK
RPSGELAASAASLTDMGGSSGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDI
SQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDA
FPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLK
GKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFI
KRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHI
PDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEAEPST
Download sequence
Identical sequences ENSFCAP00000005399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]