SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005428 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005428
Domain Number 1 Region: 741-880
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-36
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 203-353
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-35
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 1824-1979
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 521-673
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-34
Family Spectrin repeat 0.0000575
Further Details:      
 
Domain Number 5 Region: 1395-1547
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-34
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 6 Region: 1287-1438
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-33
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 7 Region: 309-461
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-31
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 8 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-30
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 9 Region: 1499-1659
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-29
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 10 Region: 1929-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-28
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 11 Region: 1657-1775
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-27
Family Spectrin repeat 0.00000137
Further Details:      
 
Domain Number 12 Region: 2091-2204
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 1207-1313
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-24
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 14 Region: 2313-2470
Classification Level Classification E-value
Superfamily EF-hand 5.98e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 15 Region: 2206-2321
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 16 Region: 1057-1175
Classification Level Classification E-value
Superfamily Spectrin repeat 5.6e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 17 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 18 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-19
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 19 Region: 472-537
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000216
Family Spectrin repeat 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005428   Gene: ENSFCAG00000005846   Transcript: ENSFCAT00000005848
Sequence length 2477
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:89031242:89081299:1 gene:ENSFCAG00000005846 transcript:ENSFCAT00000005848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGVKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEETIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSAAQIQVKREELIANWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLTAGHYASDEVREKLGVLAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMCRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMIARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWESLKSKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALRDQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIAVRQEQIDHQTRLTKEAGSVSLRMKQVQELYRSLLELG
EKRKGMLEKSCKRFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAAQQQQVSGLARRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELDQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEVKEKLDILDRERAGLEKAWAQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQSFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQVSRSKSKHQKHQAFEAELHANADRIRGVIDTGNS
LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD
LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKEL
KQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAF
ETDFTVHKDRVNDVCSNGQDLVKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDEN
SAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIAN
ITALKDQLLAAKHIQSKAIEARHASLMKRWSQLLANSATRKKKLLEAQGHFRKVEDLFLT
FAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAQADFSQLAELDR
QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN
AFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEA
LILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF
DKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFM
ISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRE
LPTAFDYVEFTRSLFVN
Download sequence
Identical sequences ENSFCAP00000005428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]