SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005431 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005431
Domain Number 1 Region: 143-280
Classification Level Classification E-value
Superfamily TNF-like 8.61e-38
Family TNF-like 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005431
Domain Number - Region: 46-61
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 3-70
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0915
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005431   Gene: ENSFCAG00000005849   Transcript: ENSFCAT00000005851
Sequence length 280
Comment pep:known chromosome:Felis_catus_6.2:F1:14601665:14609054:1 gene:ENSFCAG00000005849 transcript:ENSFCAT00000005851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPP
PLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HVASSLEKQIGQLNPPSEKRELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGGL
VINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKMMNYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
Download sequence
Identical sequences Q861W5
ENSFCAP00000005431 NP_001009352.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]