SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005513 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005513
Domain Number 1 Region: 420-618
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.35e-68
Family Hemopexin-like domain 0.00000000199
Further Details:      
 
Domain Number 2 Region: 46-176,349-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.87e-37
Family Matrix metalloproteases, catalytic domain 0.00000035
Further Details:      
 
Domain Number 3 Region: 235-292
Classification Level Classification E-value
Superfamily Kringle-like 2.11e-21
Family Fibronectin type II module 0.0000554
Further Details:      
 
Domain Number 4 Region: 295-351
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-21
Family Fibronectin type II module 0.000076
Further Details:      
 
Domain Number 5 Region: 179-234
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 3-65
Classification Level Classification E-value
Superfamily PGBD-like 1.48e-18
Family MMP N-terminal domain 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005513   Gene: ENSFCAG00000005935   Transcript: ENSFCAT00000005937
Sequence length 618
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:35128777:35152272:1 gene:ENSFCAG00000005935 transcript:ENSFCAT00000005937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQSTIETMRKPRC
GNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRI
HDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVR
VKYGNADGEYCKFPFLFNGKEYTSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTM
GGNADGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGG
NSEGAPCVFPFTFLGSKHESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAA
HEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGASPDIDTGTGPTPTLG
PVTPEICKQDIVFDGISQIRGEIFFFKDRFIWRTVTPRSKPMGPLLVATFWPELPEKIDA
VYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNRKTYI
FAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLEN
QSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences ENSFCAP00000005513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]