SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005517 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005517
Domain Number 1 Region: 391-483
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-18
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 2 Region: 591-672
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-16
Family Third domain of FERM 0.0074
Further Details:      
 
Domain Number 3 Region: 281-332
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000113
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 4 Region: 496-580
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000183
Family Second domain of FERM 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005517   Gene: ENSFCAG00000005939   Transcript: ENSFCAT00000005941
Sequence length 695
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:108989255:109006152:1 gene:ENSFCAG00000005939 transcript:ENSFCAT00000005941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMAGMKTATGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEEIKRKQD
WSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPIILRLPNRRAVRLRASFSQ
PLFQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLTKVVLAGGEHRQAG
QSGGWAPAPGAPEACLTPTCPPGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLV
LQRLPRPSSLLDKTQLHSRWLDSSRCLMQQGVKAGDMLWLRFKYYSFFDLDPKTDPVRLT
QLYEQARWDLLLEETDCTEEEMMVFAALQYHINKLSQSGEAGEPTAADPGLDDLDAALNN
LEVKLEGSAPTDVLDNLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQEE
APGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIHVRCQDEKQYAHWMAGCR
LASKGRTMADSSYASEVQAILAFLSLQRTGGGGSGNHPPGPDASAEGLNPYGLVAPRFQR
KFKAKQLTPRILEAHQNVAQLSLSEAQLRFIQAWQSLPDFGISYVVVRGTRFKGSRKDEI
LGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRI
VHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHE
Download sequence
Identical sequences ENSFCAP00000005517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]