SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005730 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005730
Domain Number 1 Region: 1294-1456
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-69
Family Pleckstrin-homology domain (PH domain) 0.00000383
Further Details:      
 
Domain Number 2 Region: 1081-1297
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-52
Family DBL homology domain (DH-domain) 0.0000000927
Further Details:      
 
Domain Number 3 Region: 500-615
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-19
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 861-970
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000652
Family PDZ domain 0.045
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005730
Domain Number - Region: 627-686
Classification Level Classification E-value
Superfamily HR1 repeat 0.0471
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005730   Gene: ENSFCAG00000006164   Transcript: ENSFCAT00000006166
Sequence length 1681
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:141643641:141755584:1 gene:ENSFCAG00000006164 transcript:ENSFCAT00000006166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LISLRAQTRLQVNMGNSESQYTLQGSKNHGNALTGAKQKPCSLKIRGLHAKDDKSLHGWG
PGSGGAGYKSRSLARSCLSHCKSNQPYGSRAGGATCKAPKGGAYAKHRTSASGNDFLSPE
NGFHYVAHQRAEERVASRDCNGHLLSCYGGNESVAATPPPPPPPGEDRKSPRVLIKTLGK
LDGCLRVEFHNGGGQEAEGAPGDAGGPVRLLRYSPSPGPGPDSPPDSRPRSSKGSSLSSE
SSWYDSPWGPAGEASEASEAEGPLPAPGTPAPRLGADLPPGAPKPFNQSSSLSSLRDLSP
DASPAAAGLRLSGEFVGARAGLSHRVSFASDMDVPSRVERRDPGPYASFTLPCRKSKAAV
EDASKKDTLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNADVQGPFPVS
ASLWSGGSAQILSQRSESTHAIGSDPLQQNIYENFMRELEMSRTNTENPETSTETADSSS
GSLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTL
LFYETYGKNCTDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTD
LENWVTAIHSACASLFAKKHGKEDTVRLLKNQTKHLVQKIDMDSKMRKMAELQLSVVSDP
KNRKAIENQIQQWEQNLEKLHMDLFRTRCYLASLQGGELPNPKSLLAAASRPSKLALGRL
GILSVSSFHALVCSRDDSALRKRTLSLTQRARNKKGIFSSLKGLDTLARKGKEKRPSVTQ
VDELLHIYGSTADGVPRDNTWEVQTYVHFQDNQGVTVTIKPEHRVEDILTLACKMRQLEP
SHHGLQLRRLVDENVEDCVPAPYECMQEQVYDEIEIFPLSVYDVQLTKTGSVSDFVLGFA
VTAQVDEHQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMETLFSEKS
VGLTLIARPPDTKGNLCSSRSDSDLFSKDQKSLLPPPNQSQLLEEFLNNFKKNTTNDFSN
VPDITTGLKRSQTDGALAQVPHGEKTGQTFGSAEQIAALCRSFNDSHTTGMEGPRGTREP
PPRPLARHLSDADRLRKVIQELMDTEKSYVKDLSCLFELYLEPLQNETFLTQDEMESLFG
SLPEMLDFQKVFLETLEDGISAASDFNTLETPSQFRKLLFSLGGSFLYYADHFKLYSGFC
ANHIKVQKVLERAKTDQAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLRELVSL
TDHESEEHYHLTEALKAMEKVASHINEMQKVYEDYGTVFDQLVAEQSGTEKEVTELSMGE
LLMHSAVSWLNPFLSLGKTRKDLELTVFVFKRAVILVYKEHCKLKKKLPSNSRPAHGSAD
LDPFKFRWLIPISALQVRLGNTAGTENNSIWELIHTKSEIEGRPETIFQLCCSDSESKTS
IVKVIRSILRENFRRHIKCDLPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSCE
WPGEPSKGSSLDSDEGSLSSSTQSSGCPPAGSSQDSPQRPPAGPADLSPGLIKESDILSD
EEDDYHQTLKQGSPTKDIEIQFQRLRISDDADANPADRRPRGEQPKLVRGHFCAIKRKAN
STKRDRGTLLKAQIRHQSLDSQSENANLDLSSVLQREFSVQSLTSVVNEECFYETGSHGK
S
Download sequence
Identical sequences ENSFCAP00000005730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]