SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005744 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005744
Domain Number 1 Region: 252-539
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005744   Gene: ENSFCAG00000006180   Transcript: ENSFCAT00000006182
Sequence length 548
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:97603656:97718716:-1 gene:ENSFCAG00000006180 transcript:ENSFCAT00000006182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSSIFQTLQMDVNRLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSVELFVSPINR
KAGISDALPSEEVLRSLNINVLHQSLSQFGIIEVSPEKNVLQGQHEADKIWSKEGFYAVV
IFLSIFVIIVTCLMLVKVIIIRIKEKFQFSLRQDKEKNQEIHLSPIALQPAQSEAKTVNS
MVQPEQAPKVLNVVVDPQGRYTPEIKATTAVCPSPFKMKPIGLQERRGSNVSLTLDMSSL
GNVEPFVAIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEI
DIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMI
NTVNDFWQMVWQEDSPVIVMITKLKEKMSKKCVLYWPEKRGIYGKVEVLVINVNECDNYT
VRNLVLKQGGHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLAATGRGPVVVHCS
AGIGRTGCFIATSIGCRQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYES
RLSAETVQ
Download sequence
Identical sequences ENSFCAP00000005744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]