SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005825 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005825
Domain Number 1 Region: 118-162,225-437,468-519
Classification Level Classification E-value
Superfamily PP2C-like 1.7e-59
Family PP2C-like 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005825
Domain Number - Region: 166-232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0475
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005825   Gene: ENSFCAG00000006269   Transcript: ENSFCAT00000006271
Sequence length 530
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:44735845:44737437:1 gene:ENSFCAG00000006269 transcript:ENSFCAT00000006271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLPFWILNSARNSIATLQGGRRLYSRCASNRNKSRWRLFSQGPGTLKSSAPCSGFAL
QKAYRHTSTEEDDFHLQLSPEQVNEVLRAGESAHKFLDLVSGAPNSVLRFESNQLAANSP
VEDRRGVASCLQTSGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSQQTLERMEGAMES
MKPLMPILQWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLNIKEALMYSFQRLD
SDISLEVQAPLEDEMTRNLSLQVAFSGATACMAHVDGVHLHVANAGDCRAILGVQEDNGM
WSCLPLTRDHNAWNQAELSRLKREHPESEDRTVIVDNRLLGVLMPCRAFGDVQLKWSKEL
QRSVLERGFDTEALNIYQFTPPHYHTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDVLD
NEDVVRLVVEHLAEASRHKPDLAQRPANLGLMQSLLQQRRAQGLRAADQNAATRLIRHAI
GSNEYGEMEPERLTAMLTLPEDLARMYRDDITVTVVYFNSDSIDAYYKGG
Download sequence
Identical sequences M3W5L0
XP_006941635.1.62641 XP_006941636.1.62641 XP_006941637.1.62641 XP_019675413.1.62641 ENSFCAP00000005825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]