SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005883 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005883
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-47
Family Dual specificity phosphatase-like 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005883   Gene: ENSFCAG00000006331   Transcript: ENSFCAT00000006333
Sequence length 211
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:49589274:49591948:1 gene:ENSFCAG00000006331 transcript:ENSFCAT00000006333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWASMTFMARFSRSSSRSPVRTRGVLEEMPAVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDIANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALNQPGGRILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences A0A2I2U656
ENSFCAP00000005883 XP_003984838.1.62641 XP_006930789.1.62641 XP_014925653.1.86478 XP_015399740.1.5354 ENSFCAP00000005883 9685.ENSFCAP00000005883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]