SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006144 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006144
Domain Number 1 Region: 173-315
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 69-175
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-30
Family Second domain of FERM 0.0000935
Further Details:      
 
Domain Number 3 Region: 2-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-21
Family First domain of FERM 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006144   Gene: ENSFCAG00000006614   Transcript: ENSFCAT00000006616
Sequence length 540
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:61429724:61473081:1 gene:ENSFCAG00000006614 transcript:ENSFCAT00000006616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMC
FRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQQAEIGDYDP
GKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPH
PCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIIL
TYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMES
SAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHST
PVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQIN
GATCSIEEEKESEASTPTATEVEALGGELRALCQGHGRPEEEQVNKFVLSVLRLLLVTMG
LLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences ENSFCAP00000006144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]