SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006210 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006210
Domain Number 1 Region: 240-367
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 369-473
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-24
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 13-106
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-16
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 151-234
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000434
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006210   Gene: ENSFCAG00000006682   Transcript: ENSFCAT00000006683
Sequence length 1274
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:9076358:9162154:1 gene:ENSFCAG00000006682 transcript:ENSFCAT00000006683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHMTQAIPFDDPRLESYQIVPPAPRSVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEG
KLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLK
SNPVKVRFSEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILT
LQEKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPK
DPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKIS
LKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKF
LSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEM
FTEEESLVRVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTG
TQETGTENKGKHNLLGPDWNCIPQMTTFIGEGEQEAQITYIDSKQKTVDITDGALCPKDH
RHLYLDNTYNPDELNQPLTQPGDAPCEADYRSLTQRSLLTLSGPDALKKAQESPRGAKVS
FIFGDLALDDGRNPPTLGYERLLEESPELLEKQRDLYISGANDMKGLDLAPDAESIQFVA
NSVYANIGDVKHFEAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGAMSQPAILN
LSGSSDDIIDLTSLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFLE
DKEPGRSLQNDEIPVSLIDAVPTSAEGKCEKGLGNTVVSTLEALEALSVSEEQQTSDNSG
HAGVAILRAYSPESSSDSGNETNSSEMTESSELATAQKQSESLSRMFLAAHEGYHPLAEE
QTEFPTSKTPAGGLPPKSSHALAARPVTDLPPKVVPSKQILHPDPMEMEPETMETKSVTD
YFSKLHMGSVVYSCTSKRKSKLADGEGKAPPSGNMPGKKQQGTKTAEAEEDAKGKFGTVS
SRDSQQHLSTFNLERTAFRKDSQRWYVATEGAVAEKSGLEAAAGITFPRASGLGTREAEE
KDEGAPDGEAGEVSGLGQRDHFLTDVTCVSSAKDLDDPGDTDPSTCDHPSKLPEAEESVA
RLCDYHLAKRMSSLPSECHFSLQSSQGSSVDAGCGTGSSSSTCPTPVESPLCPSMGKHLI
PETAGKGMGYVPAEERAAGLPNHGATFKELHPQAEGMCPRMTVPALHTAINAEPLFGTLR
DGCHRLPKIKETTG
Download sequence
Identical sequences ENSFCAP00000006210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]