SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006427 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000006427
Domain Number - Region: 24-55
Classification Level Classification E-value
Superfamily RING/U-box 0.00505
Family RING finger domain, C3HC4 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006427   Gene: ENSFCAG00000006923   Transcript: ENSFCAT00000006925
Sequence length 277
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:73010151:73024219:-1 gene:ENSFCAG00000006923 transcript:ENSFCAT00000006925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCEDMLLCNYRKCRLKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLD
IVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQ
MEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDS
LRLRNITIANQESMLEPSMIAQSGVFGFPLGNNSKFPLDSTPVQNRGGGDGDFQFRPFFV
ASPTAPEPSNSFFSFASPGREVEQQQISSRAFKVKRI
Download sequence
Identical sequences M3W6R6
ENSFCAP00000006427 XP_003987425.1.62641 XP_019688284.1.62641 XP_019688285.1.62641 XP_019688286.1.62641 XP_019688287.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]