SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006487 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006487
Domain Number 1 Region: 10-103
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-28
Family PDZ domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006487   Gene: ENSFCAG00000006992   Transcript: ENSFCAT00000006994
Sequence length 145
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:117350537:117384090:-1 gene:ENSFCAG00000006992 transcript:ENSFCAT00000006994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQ
EGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRSEGEPSGIPI
ALVLVPVFALTMVAAWAFMRYRQRL
Download sequence
Identical sequences A0A2I2UDJ5
XP_003987836.1.62641 XP_014927202.1.86478 XP_015398856.1.5354 XP_019306931.1.44245 ENSFCAP00000006487 ENSFCAP00000006487 9685.ENSFCAP00000006487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]