SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006637 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006637
Domain Number 1 Region: 147-344
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.62e-57
Family Prokaryotic proteases 0.0000000161
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-23
Family HtrA-like serine proteases 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006637   Gene: ENSFCAG00000007157   Transcript: ENSFCAT00000007159
Sequence length 458
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:93002192:93005202:1 gene:ENSFCAG00000007157 transcript:ENSFCAT00000007159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRAGRGAGWNLWGWRALGGVPWGKGPLLTPDLRALLTSGTPDPRARVTYGTPSLWAR
LSGGVPEPRTCLTSGTSDSRARLTAGSPDLKTREVSETPGTRPRIWLAVALGAGGAVLLL
LWGGGRGPPAVLASVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAMVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGISGSQRR
YIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQL
VQNAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE
Download sequence
Identical sequences M3W782
ENSFCAP00000006637 XP_003984202.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]