SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006709 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006709
Domain Number 1 Region: 1350-1638
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.57e-109
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000277
Further Details:      
 
Domain Number 2 Region: 1602-1883
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.39e-76
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000205
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-44
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 510-704
Classification Level Classification E-value
Superfamily Fibronectin type III 2.59e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 738-886
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-19
Family Fibronectin type III 0.00036
Further Details:      
 
Domain Number 6 Region: 31-133
Classification Level Classification E-value
Superfamily Immunoglobulin 4.52e-18
Family I set domains 0.0042
Further Details:      
 
Domain Number 7 Region: 894-1001
Classification Level Classification E-value
Superfamily Fibronectin type III 3.45e-17
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 9 Region: 230-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000203
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000006709
Domain Number - Region: 1041-1087
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0238
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006709   Gene: ENSFCAG00000007234   Transcript: ENSFCAT00000007238
Sequence length 1891
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:3800444:3860344:-1 gene:ENSFCAG00000007234 transcript:ENSFCAT00000007238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAWGPGVASVVGPVGLLVVLLVGGCTAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDQSAGAVLRIQPLRTPRDENVYECVAQNSVGEVTVHA
KLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMS
HEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVA
MSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITITWDSGNPDPVSYYVIEYKSKSQD
GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNV
QARMLSATTMIIQWEEPVEPNGLIRGYRIYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLE
DETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLSWSPPRQESI
IKYELLFREGDHGREVGRTFDPATAFVVDDLKPNTEYAFRLAARSPQGLGAFTSVVRQRT
LQSNNRQPPQDVKCVSTRSTAILVSWRPPPPETHNGLVSYSVRYRPLGSEDPQPKEVNGI
PPTATQILLEALDKWTEYRITTVAHTEVGPGPESSPVVIRTDEDGEHPPRPTPLRLGAFR
LCRTGAGWWSEGRSHSGSLGFEVRQMGTGTPQGSRTQGTGRDPQEMVITNLQPETAYSIT
VAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLAHWEPPAGTAEDQVLGYRL
QFGREDAPLATLEFPPTEDHYTAPGVHKGATYVFRLAARSRGGLGEEAAEALSIPEDAPR
GHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAVAEP
GAENVLTLQGLKPDTAYDLQVRAHTRQGPGPYSPPVRYRTFLRDQGRAQLALRLGLWSAL
NLGWELGIEAQSGVRAQIQYNGLTLDVDGRTTKKLITHLKPNTFYNFVLTNRGSSLGGLQ
QTVTAWTAFNLLSAKPSVAPKPDSDGFIMVYLPDGQSPVPVQNYFIVMVPLRKSRGGQFL
APLGSPEDMDLEELIQDISRLQRRSLRHSRQLEAPRPYIAARFSVLPPTFHPGDQKQYGG
FDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDPFQLDNPDPQPIVDGEEGLIWVIGPV
LAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPA
WRFHRPVPVTADSVHLSCAGFSXSLPLQSIDPGQQFTWEHSNLEVNKPKNRYANVIAYDH
SRVILQPIEGIVGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATIVMM
TRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQF
QFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIK
PEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ
VEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV
EGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKC
HQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARGGGDVTEGAGRGLRAAGTGRS
HRSGEGRRSVTQVGAVPAPPSPNSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRT
QRPAMVQTEDEYQFCYQAALEYLGSFDHYAT
Download sequence
Identical sequences ENSFCAP00000006709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]