SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006963 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006963
Domain Number 1 Region: 842-1117
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-71
Family Protein kinases, catalytic subunit 0.00000521
Further Details:      
 
Domain Number 2 Region: 548-827
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-43
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 413-516,553-577
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000289
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 4 Region: 339-401
Classification Level Classification E-value
Superfamily PH domain-like 0.0000418
Family Third domain of FERM 0.023
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000006963
Domain Number - Region: 134-227
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0335
Family Second domain of FERM 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006963   Gene: ENSFCAG00000007517   Transcript: ENSFCAT00000007519
Sequence length 1138
Comment pep:novel chromosome:Felis_catus_6.2:A2:12869602:12883793:-1 gene:ENSFCAG00000007517 transcript:ENSFCAT00000007519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGDQPTAGAMGLLEQTKAGGEQATPMAPPKAGALHVLLPPRGPGPPQRLSFSFGDHSAE
ELCVWAAKASGILPVYHSLFALATEDLSYWYPPSHIFSVEDASTQILLYRLRFYFPNWFG
LEKCHRFGLRKDLASAILDLPVLEHLFAQHRNDLVSGRLAVGLSLKEQGECLSLAVLDLA
RMAREQAQQPEELLKTVSYKACLPPDLRDLIQGLSFVTRKRIRRTVRRALGRVTACQADR
HSLMAKYIMDLERLDPARAAETFLVSLPGAAGGQDAPGLLRVAGDSGIHWSPGGHEVWEA
AGRDRRQGRSLGRRGGRVGGVKAWKDWESFERGPLRGALQPFCDFPEIVDISIKQAPRVG
PAGEHRLVTVTRTDNQILSFVALVDGYFRLTSDSRHFFCKEVAPPRLLEEVAEQCHGPIT
LDFAINKLKTGGSLPGSYVLRRSPQDFDSFLLTVCVQTPLGPDYKGCLIRCDPTGTFSLA
GLGRPHSSLRELLAACWDAGLHVDGVALNLTSCCAPRPKEKSNLIVVRRGCSTPTSSLVW
PQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEAVDGEARETEVLLKVMDAK
HRNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSVMVQEFVRLGALDTYLRKSGHLVPA
SWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGADGNLPFIKLSDPGVSPTVLSL
EMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFSGIPMPISTLDPAKKLQFYEER
QHLPAPKWMELATLIQQCMAYEPGQRPSFRAIIRDLNSLITSERTERVSRRIEAPQQDPT
IFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQIL
KALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYASQICK
GMEYLGSRRCVHRDLAARNILVESETHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYA
PESLSDNIFSRQSDVWSFGVVLYELFTYGNKNCSPSAEFLRMMGCERDVPALCRLLELLA
EGQRLPAPPACPGEVHELMKLCWAPSPQDRPTFSALGPQLDTLWSGSRGDVATLWASC
Download sequence
Identical sequences ENSFCAP00000006963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]