SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006969 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006969
Domain Number 1 Region: 367-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-87
Family Protein kinases, catalytic subunit 0.00000158
Further Details:      
 
Domain Number 2 Region: 182-282
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.22e-41
Family MAST3 pre-PK domain-like 0.00000241
Further Details:      
 
Domain Number 3 Region: 943-1033
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-18
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006969   Gene: ENSFCAG00000007523   Transcript: ENSFCAT00000007525
Sequence length 1303
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:13044194:13079389:1 gene:ENSFCAG00000007523 transcript:ENSFCAT00000007525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGNSPLD
SPRNFSAASAVNFPFARRADGRRWSLASLPSSGYGTNTPSSTVSSSSSSRERLHQLPFQP
TPDELCFLSKHFRSSESVADEEGGHRSPHLRPRSRSLSPGRTTGNFDNEIVMMNHVYRER
FPKATAQMEGRLEEFLAAFAPGARLALADGVLGFIHHQIIELARDCLAKSGEALVTSRYF
MEMQEKLERLLQDAHERSDSEEVGFIVQLVRKLLIIISRPARLLECLEFDPEEFYHLLEA
AEGQAREGQGIKTDLPQYIIGQLGLAKDPLEEMVPLSHLEEGGQPPAPESPESRALVGPS
RRKPCENDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLVLRNQIQQVFVERDI
LTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARMYFAETVLAL
EYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDTREFVDK
QVCGTPEYIAPEVIFRQGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIM
WPEGDEALPADAQDLITRLLRQSPLDRLGTGGTHEVKQHPFFRTLDWAGLLRHKAEFVPQ
LEAEDDTSYFDTRSERYRHLGSEDEETNDEESSTEIPQFSSCSHRFSKVYSSSEFLAAQP
TPTFAERSFSEDREEGWERSGEGEYGRRLSMDIRLRSWTSSGTSCPSSSQPERGPSPSLL
STISLDTMPKFAFSSEDEGASPASAGPKRPIFILGEPDPPPAATPVMPKPSSLSADPAAL
SHARLRSNSIGTRHSTPRALDAGRGRRLGGQRDPAPEKSRASPSGGRVPKSASVSALSLI
ITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHSSGKKYGFSLR
AIRVYMGDSDVYTVHHVVWSVEEGSPAQEAGLRAGDLITHINGESVLGLVHMDVVELLLK
SSNKIALRTTALENTSIKVGPARKNVAKGRMARRSKRSRRRETQDRRKSLFKKISKQSSV
LHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTTPCCSPAPDAPADTASPPSASPSSSS
PASPAAAGHTRPSSLHGLAAKLGPPRPKAGRRKSTSSIPPSPLACPPVPVPPPRSPSPLP
GHPPAPARSPRLRRGQSADKLGSGERLDGELGRRGRGPDSELVVMRRLHLSERRDSFKKQ
EAVQEVSFDEPPEEAAGPLTSVPQIAVEGAEAVPGALGPAGKD
Download sequence
Identical sequences ENSFCAP00000006969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]