SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006992 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006992
Domain Number 1 Region: 193-249
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-16
Family KRAB domain (Kruppel-associated box) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000006992
Domain Number - Region: 92-173
Classification Level Classification E-value
Superfamily Tropomyosin 0.0118
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006992   Gene: ENSFCAG00000007550   Transcript: ENSFCAT00000007552
Sequence length 397
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:162061472:162078868:1 gene:ENSFCAG00000007550 transcript:ENSFCAT00000007552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLL
NLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENMENLLRNRNF
WVLRLPPGSKGEVPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLVSLDAE
GAVPKPDAPSQAEPREEPCVWEQRDPEEREILMDPDTGAEPLVPAQDSSSQVKREEALCV
RGQRGLEERAVPTESITDSPASAQDLLSRIKQEEHPCVWDQQDLAERDIPTDPNSGTESL
ISAHDILSWIKQEEQPYPWGPRDSMEGELGLDSGPSE
Download sequence
Identical sequences ENSFCAP00000006992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]