SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007005 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007005
Domain Number 1 Region: 197-316
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 27-107
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.00000118
Family ATP sulfurylase catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007005   Gene: ENSFCAG00000007565   Transcript: ENSFCAT00000007567
Sequence length 322
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:60462409:60472597:1 gene:ENSFCAG00000007565 transcript:ENSFCAT00000007567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAILEDYADPFDVQETAEGPAGASGAPEKVPENDGYMEPYEAQKMMAEIRSSKETAAQPL
PLYDTPYEPEEEGTTPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAVDIK
VIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDGSAQFEGSEKSCLSPGREE
KGRLPPRLSAGNPKSAKPLNVEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCK
EASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYAS
RKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences ENSFCAP00000007005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]