SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007090 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007090
Domain Number 1 Region: 40-140
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-22
Family PDZ domain 0.017
Further Details:      
 
Domain Number 2 Region: 136-236
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-21
Family PDZ domain 0.047
Further Details:      
 
Domain Number 3 Region: 242-344
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-21
Family PDZ domain 0.0000172
Further Details:      
 
Domain Number 4 Region: 938-1038
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.0000681
Further Details:      
 
Domain Number 5 Region: 547-650
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-20
Family PDZ domain 0.0000372
Further Details:      
 
Domain Number 6 Region: 656-747
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.0000344
Further Details:      
 
Domain Number 7 Region: 449-547
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-20
Family PDZ domain 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007090   Gene: ENSFCAG00000007655   Transcript: ENSFCAT00000007658
Sequence length 1053
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:54268184:54297073:1 gene:ENSFCAG00000007655 transcript:ENSFCAT00000007658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLHGNESGTQGLFSFLPADDGPYSKGGKDAGGTDVALACRRQSIPEEFRGVTVVELTKKE
GSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDLLNVGDYIRSVNGIHLTRLRHDEIITL
LKNVGERVVLEVEYELPPPAPENSPGIITKTVDVSLYKEGNSFGFVLRGGAHEDVHKTRP
LVLTCVRPGGPADREGSLKVGDRLLSVDGIPLHGASHATAMATLQQCSHEALFQVEYDVA
IPDTVANASGPLIVEITKTPGSALGISLTTGSHRNKSVITIDRIKPASVVDRSGALHAGD
HILSIDGTSTAHCSLLEATKLLANVSEKVRLEILPAPQSRRPLKPSEAVKVQRSEQPHRW
DPCVLSCHSPRPGHCRTPTWATPAGQDQSRSLSSTPFSSPTMNHAFPCTNPSTLPRGSHP
MSPRTTMGRRRQRRREHKSSLSLASSTVGPGGQIVHTETTEVILCGDPLSGFGLQLQGGI
FATETLSSPPLVRFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAH
RVALEVEFDVAESVIPSSGTFHVKLPKRRGVELGITIGSTSRKRGEPLIISDIKKGSVAH
RTGTLEPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDEQETTGAISY
TVELKRYGGPLGITISGTEEPFDPIVISGLTKRGLAERTGAIHVGDRILAINSVSLKGRP
LSEAIHLLQVAGETVTLKIKKQLDRPLPHRKSGSLSEASDADEDPPEALKGGLLAARFSP
AVPSVDSAVESWDSTATEGGFGGPGSYTPQAAARNVTPQEWRPSRLRSSPPPTEPRRTSY
TPAPTDESFPEEEEEEEEEEEEDWEPPTSPAPGPAREEGFWRMFGEALEDLESCGQSELL
RELEASIMTGTVQSVALEGRPGHRPWRKSQEVRASPEETQELLVPTPLEMHKVTLHKDPL
RNDFGFSVSDGLLEKGVYVHTVRPDGPAQRGGLRPFDRVLQVNHVRTRDFDCCLAVPLLA
EAGDVLALVISRNPLAQSSRTPRAPGPSSPRML
Download sequence
Identical sequences ENSFCAP00000007090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]