SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007146 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007146
Domain Number 1 Region: 1294-1434
Classification Level Classification E-value
Superfamily PH domain-like 7.11e-53
Family Phosphotyrosine-binding domain (PTB) 0.00000206
Further Details:      
 
Domain Number 2 Region: 172-300
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.67e-35
Family PLC-like (P variant) 0.0021
Further Details:      
 
Domain Number 3 Region: 7-168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-27
Family Dual specificity phosphatase-like 0.00021
Further Details:      
 
Domain Number 4 Region: 1160-1281
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007146   Gene: ENSFCAG00000007717   Transcript: ENSFCAT00000007719
Sequence length 1440
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:63644386:63764396:-1 gene:ENSFCAG00000007717 transcript:ENSFCAT00000007719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGRELDLTYITERIIAVSFPASCSEESYLHNLQEVTRMLRSHGDNYLVLNLSEKRYDL
TKLNPKILDVGWPELHAPPLDQVCTVCKAQESWLNSDPQHVVVIHCRGGKGRIGVVISSY
MHFTNVSASADQALDRFAMKKFYDDKVSDLMQPSQKRYVQFLSGLLSGTVKMNTSPLFLH
FVILHGTPNFDTGGACRPFLKLYQAMQPVYTSGIYNIGPGNQGRVHIAIEPAQLLKGDIM
IKCYHKKYRSATRDVIFRLQFHTGAVQGCGLVFGKEDLDTASQDDRFPDNGKIELVFSAT
PEKIQGSLGGGSGPMGSRHTLPPLCVLGHCHESLSAGGEVPHTQGPVDGSLYAKVRKKSA
SDPGVPGGAPAVPTATSPDHGDHTLSVSSDSGHSTASVRTDRTEERLAAGPRRGLSPQEK
AELDQLLSGFGLEDSGSPLKDMTDAPSKHSGTRHVVPAQVHVNGDAALKERETDILDDDM
PGHDLHSVDSIGTLSSSEGHQSAHLGPFACYQSSQNSLLSDGFGSSAGEDAHGGLAPDLS
LGVDAPFERERAFGIREAKQPPPALRRPSVSAQTQAYGQSGYSTHTWVCQQQIVAAQQYS
FAPDGEARLVGRGPEDGSGLLQAQPRVPVTPTRGTGSRVAPQRSVGPGPHLPDAQRPPPG
KAFKPRFPDVRVLNGTGPEPGVDPSPGSPTLDIDQSIEQLNRLILELDPTFEPVPTHMNT
PGIQANGPMPPDSLGGRLWDTGEGPGRAPVRQGSPGDEPPGGRFRKLSLGQYDNDGAGQP
AFPKCGWGKTPGAEQAVSLAPFLSPADAKETVAAAYPPDPDGISGRNFSPTKSGSDSPSP
TPAFPVSAETLYVTTPPRYAPFSPPGSQTGSASGLYRGAHAEPRGCPEIPHRAVGMSESP
VGPKAATLRADMPAAPSSFQRAFTSSTTSGSSPGQRRESPPSAELPWVESSPKASMALLG
SGRPAGSVLGSGEFPGSSLGPDSPGRPHLPPAELQAPFHNHQLSLAEPPEALGPPSSQAF
LGFGTAPVGSCLAPGDDPGALLVHSHGTPQAPSTPRTAAAAGDSGFLSSSFLTVTPGHSG
HHSPLTLPGQPPLPEKKRASEGDRSLGSASPSSSGFSSPHSGSSMSIPFPNILPDFPKAL
EPVAPSPDNAGDKHVSVNFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGA
YGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVC
QHSITPLALPCKLLIPDRDPLEEIADSSPQTAANSAAELLKQGAACNVWYLNSVETESLT
GHQAVQKALSLTLVQEPPPLCTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDP
QDRKWITDGPCSRVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPKKI
Download sequence
Identical sequences ENSFCAP00000007146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]