SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007179 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007179
Domain Number 1 Region: 396-539
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 292-397
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-36
Family Second domain of FERM 0.000000871
Further Details:      
 
Domain Number 3 Region: 211-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-26
Family First domain of FERM 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007179   Gene: ENSFCAG00000007752   Transcript: ENSFCAT00000007754
Sequence length 864
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:20948519:21067757:1 gene:ENSFCAG00000007752 transcript:ENSFCAT00000007754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSQHQQQKEEGEGATNSGQQETQLEEPSQEAAEGDNQCEQKLKTSNGD
TPTHEDLTKNKERTSENRGLSRLFSSFLKRPKSQVSEEEGKEVESAKEKCEGGQKEIEFG
TGLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEHREDPDFETKEGGGLEEC
CKIEVKEESPESKAERELKTSQKSIRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRV
CEHLNLLEEDYFGLAVWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTED
ITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGADYVSDFKLAPNQ
TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRA
SRSLDGAAAVDSDRSPRPTSAPAIAQSQVTEGSVPDASVKKTVVSKAQKETVKFEVKKEE
EPPEQAEPEPTEVWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIY
IRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNIN
GQLPTGEGPPLVKTQTVTISDTASALKSEIPTKDVPIVHTETKTITYEAAQTDDSNGDLD
PGVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKE
AKEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences XP_019692075.1.62641 ENSFCAP00000007179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]