SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007286 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000007286
Domain Number - Region: 428-437
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007286   Gene: ENSFCAG00000007867   Transcript: ENSFCAT00000007869
Sequence length 1599
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:19808796:19813595:-1 gene:ENSFCAG00000007867 transcript:ENSFCAT00000007869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVKPQGLVVTSSAVCSSPDYLREPKYYPGGPPTPRPLLPTRPPASPPDKAFAHTFSENP
RPPPRRDPSTRRPPVLAKGDDPLPPRAARPVSQARCPTPAGDGNSSRRRWDNGRVNLRPV
VQLIDIMKDLTRLSQDLQHSGVHLDCGGLRLSRPPAPPPGDLQYSFFSSPSLANSIRSPE
ERATPHAKSERPSHPLYEPEPEPRDSPQPGQGHSPGATAAATGLPPEPEPDGPDYSELAD
ADILSELASLTCPEAQLLEAQALEPPSPEPEPQLLDPQPRFLDPQALEPLGEALELPPLQ
PLADPLGLPGLALQALDTLPDSLESQLLDPQALDPLPKLLDVPGRRLEPQQPLGPCPLAE
PLRLDLCSPHGPHGPEGHPKYALRRTDRPKILCRRRKAGRGRKADAGPEGRLLPLPMPTG
LAAALAEPPPPPPPPPPALPGPGPVPELEPESSQTPVAPTRKGKCRGVRRMVVKMAKIPV
SLGRRNKTTYKVSSLSSSLSVEGKELGLRVSAEPTPLLKMKNNGRNVVVVFPPGEMPIIL
KRKRGRPPKNLLLGPGKPKEPAVVAAEAATVAAATMAMPEVKKRRRRKQKLASPQPSYAA
DANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPSEPESVHQAPDTQSISHFLHRVQ
GFRRRGGKAGGFGGRGGGHAAKAARCSFSDFFEGIGKKKKVVAVTAAGVGGPSLTELGHP
RKRGRGEVDAMTGKPKRKRRSRKNGTLFPEQVPSGPGFGEAGAEWAGDKGGGWAPHHGHP
GGQAGRNCGFQGTEAQAFASTGLESGASGRGSYYSTGAPAGQTELSQERQNLFTGYFRSL
LDSDDSSDLLDFALSASRPESRKASGTYAGPPTSTLPSQRGLATFPSRGAKASPVAVGSS
GAGADPSFQPVLPSRQTFPPGRAASYGITPATSDCRAAETFPKLAPPPSAVARSPTTHPP
TNTYPPQYGGYGAGQSVFAPAKPFTGQDCANSKDCSFAYGSGNSLPASPSSAHSAGYAPP
PTGGPCLPPSKASFFNSSEGAPFSGSAPTPLRCDSRASTVSPGGYMVPKGTTASATSAAS
AASSSSSSFQPSPENCRQFAGASQWPFRQGYGGLDWASEAFSQLYNPGFDCHVSEPNVIL
DISNYTPQKVKQQTAVSETFSESSSDSTQFNQPVGGGFRRANSEASSSEGQSSLSSLEKL
MMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPSSASATASGYPSKR
STGPRQPRGGRGGGACSAKKERGGAAAKAKFIPKPQPVNPLFQDSPDLGLDYYSGDSSMS
PLPSQSRAFGVGERDPCDFMGPYSMNPSTPSDGTFGQGFHCDSPSLGAPELDGKHFPPLA
HPPTVFDAGLQKAYSPTCSPTLGFKEELRPPPTKLAACEPLKHGLQGASLGHAAAAQAHL
SCRDLPLGQPHYDSPSCKGTAYWYPPGSAARSPPYEGKVGTGLLADFLGRTEAACLSAPH
LASPPATPKADKEPLEMARPPGPPRGPAAAAAGYGCPLLSDLTLSPVPRDSLLPLQDTAY
RYPGFMPQAHPGLGGGPKSGFLGPMAEPHPEDTFTVTSL
Download sequence
Identical sequences M3W8J2
9685.ENSFCAP00000007286 XP_006934524.1.62641 XP_006934525.1.62641 XP_019287932.1.44245 XP_019287934.1.44245 XP_019287935.1.44245 XP_019287936.1.44245 XP_019287937.1.44245 XP_019287938.1.44245 XP_019287939.1.44245 XP_019692022.1.62641 ENSFCAP00000007286 ENSFCAP00000007286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]