SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007404 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007404
Domain Number 1 Region: 217-362
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 107-216
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-38
Family Second domain of FERM 0.000000706
Further Details:      
 
Domain Number 3 Region: 515-603
Classification Level Classification E-value
Superfamily Moesin tail domain 3.14e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 21-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-26
Family First domain of FERM 0.00000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007404   Gene: ENSFCAG00000007992   Transcript: ENSFCAT00000007994
Sequence length 603
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:144984718:145009265:-1 gene:ENSFCAG00000007992 transcript:ENSFCAT00000007994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPNCAHTETQQLSTVSGHSQRINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREV
WYFGLQYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLF
FLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKETHKSGYLSSERLIPQRVMDQHK
LTRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQ
LCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMR
EKEELMLRLQDFEQKTKKAEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEE
LERQAADQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEE
LHLVMTAPPPPPPVYEPVSYHVQDSLQDEGAEHTGYSAELSSEGILDDRNEEKRITEAEK
NERVQRQLMTLTNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEF
EAM
Download sequence
Identical sequences ENSFCAP00000007404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]