SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007433 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007433
Domain Number 1 Region: 61-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-38
Family Ankyrin repeat 0.00053
Further Details:      
 
Domain Number 2 Region: 382-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000183
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007433   Gene: ENSFCAG00000008024   Transcript: ENSFCAT00000008026
Sequence length 431
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:44191563:44197694:1 gene:ENSFCAG00000008024 transcript:ENSFCAT00000008026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEETFPFTSSALRALRLQREWLEWEDRRRAAAQQCRSQRCPPSTRARLTRPRRCCRDPA
VHNALFSGDLPQVQALFQDEDAANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLTIAAA
RGYTDCARHLIRQGAELDARVGGRAALHEACARAQSDCVQLLLTFGAKANVLSEEGTTPL
HLCTAPESLQCAKLLLEAGATVNLAAQDSEMTPLHVAAARGLEEHVALYLEHGANVHLRT
SQGETALNAACAGAEGPGSCRXXXXXXXRCANGCGGLAELLLRHGACAGVPNGAGHTPMD
CALQAVQDAPNWEPEVLFSALLDYGAEPVRPEMLKHCANFPRALEVLLNAYPYVPSCDTW
VEAVLPELWQEHEAFYTSALCMVNQPRRLQHLARLAVRAQLGGRCRQAVASLPLPPVLRD
YLMLRAEGRIQ
Download sequence
Identical sequences ENSFCAP00000007433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]